PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC62_p3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family ARF
Protein Properties Length: 633aa    MW: 71624 Da    PI: 6.7236
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC62_p3genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B378.76.3e-25109210199
               EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
        B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
               f kvlt sd++++g +++ +k+a+e+       +  ++ +++l+ ed +g +W++k+i+r++++r++lt+GW+ Fv a++L +gD++vF   + +++el+v
  RrC62_p3 109 FSKVLTASDTSTHGGFSVLRKHATEClppldmtQ--QTPTQELVAEDVHGYQWKFKHIFRGQPRRHLLTTGWSTFVTAKRLVAGDTFVFL--RGENGELRV 205
               88****************************9643..445569************************************************..449999*** PP

               EEE-S CS
        B3  95 kvfrk 99 
               +v+r+
  RrC62_p3 206 GVRRA 210
               ***97 PP

2Auxin_resp110.32e-36235314183
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                 a ha++tks+F+v+Y+Pr+  s+F+++++k+++a+++k+svGmRfkm+fe+eds+err+sGtvvgv+d+++ +W++S+Wr L+
    RrC62_p3 235 ACHATQTKSMFTVYYKPRT--SQFIISLNKYLEAMNNKFSVGMRFKMRFEGEDSPERRYSGTVVGVKDCST-HWKDSNWRRLE 314
                 689***************6..9**********************************************777.********985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.0E-42100224IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.44E-38103238IPR015300DNA-binding pseudobarrel domain
CDDcd100171.82E-21107209No hitNo description
PROSITE profilePS5086312.788109211IPR003340B3 DNA binding domain
SMARTSM010191.3E-24109211IPR003340B3 DNA binding domain
PfamPF023621.2E-22109210IPR003340B3 DNA binding domain
PfamPF065075.9E-33235313IPR010525Auxin response factor
PfamPF023095.1E-8498553IPR033389AUX/IAA domain
SuperFamilySSF542778.5E-13511593No hitNo description
PROSITE profilePS5174525.719517609IPR000270PB1 domain
PfamPF023091.8E-6560605IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 633 aa     Download sequence    Send to blast
MYGELWKLCA GPVVDVPQAE ERVFYFPQGH MEQLEASTQQ DLNAVKPTKP LFDLPPKILC  60
RVMDVRLQAE KDTDEVYAQI MLMPEETVDE PMSPDLPPPE SQRPKVHSFS KVLTASDTST  120
HGGFSVLRKH ATECLPPLDM TQQTPTQELV AEDVHGYQWK FKHIFRGQPR RHLLTTGWST  180
FVTAKRLVAG DTFVFLRGEN GELRVGVRRA NRQQTNMPSS VISSHSMHLG VLATACHATQ  240
TKSMFTVYYK PRTSQFIISL NKYLEAMNNK FSVGMRFKMR FEGEDSPERR YSGTVVGVKD  300
CSTHWKDSNW RRLEVHWDEP ASISRPDKVS PWEIEPFVSS ENVSQSVMPK NKRPRHFSEV  360
SALDVGKTAS NLWGSALAQS HELAQSCITS QRNSPRQCYR DATEDAKKSD WPISPYSASN  420
LSKNTTLNDQ MIFPVEQKKH ETTTASYRLF GVDLLSSSVP APEEKAALMQ PINITKPAPD  480
SNSDPKSEVS KLSEEKKQEP AQASSKEVQS KENSSTRSRT KVQMQGVPVG RAVDLTVLNG  540
YSELIDDLEK LFDIEGELKS RNQWEIVFTD DEGDMMLVGD DPWPEFCNMV KRIFIWSKEE  600
VKKMTPGNQL RKLLTEVDTA LTTTISKTEN HSN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-165433922357Auxin response factor 1
4ldw_A1e-165433922357Auxin response factor 1
4ldw_B1e-165433922357Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN9794740.0JN979474.1 Brassica rapa subsp. pekinensis auxin response factor 9 (ARF9-2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013737711.10.0PREDICTED: auxin response factor 9-like
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLA0A078FFX50.0A0A078FFX5_BRANA; Auxin response factor
STRINGBra019255.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27642762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.10.0auxin response factor 9